AREB6 Antibody

Legacy ID:18-003-43000
Size:0.1 mg
purchase this item

* Required Fields

AREB6 Antibody - Product Information

Format Lyophilized powder. Add 100 ul of distilled water. Final anti-AREB6 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Immunogen Synthetic Peptide within the following region: YNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPGRS
Immunogen Species Human
Intended Use Research Use Only
Molecular Weight 124kDa
Storage For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
Conjugate N/A

AREB6 Antibody - Reference Information

Description Transcription Factor AREB6 / transcription factor 8 /zinc finger homeodomain enhancer-binding protein inhibits interleukin-2 (IL-2) gene expression. May be responsible for transcriptional repression of the IL-2 gene. Enhances or represses the promoter act
GI Number 28077091
NCBI Acc Number NP_110378.2
Related Product Names AREB6; BZP; MGC133261; NIL-2-A; NIL-2A; TCF8; ZEB; ZFHEP; ZFHX1A; FECD6; NIL2A; PPCD3; DELTAEF1
Short Description N/A
Swiss Prot Number P37275

GenWay Trust

Of course we value your privacy and your data security but most of all we value your trust.
Online Payments
GenWay Biotech Inc is a BBB Accredited Business. Click for the BBB Business Review of this Laboratories - Research & Development in San Diego CA