MICA Antibody

GenWay ID:GWB-864CC7
Legacy ID:18-003-44554
Size:0.1 mg
Application(s):WB
Reactivity:Human
Clonality:Polyclonal
Source:Rabbit
purchase this item
$268

* Required Fields

MICA Antibody - Product Information

Format Lyophilized powder. Add 100 ul of distilled water. Final anti-MICA antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Immunogen Synthetic Peptide within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT
Immunogen Species Human
Intended Use Research Use Only
Molecular Weight 42kDa
Storage For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
Conjugate N/A


MICA Antibody - Reference Information

Description MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.
GI Number 4557751
NCBI Acc Number NP_000238.1
Related Product Names DAQB-48K1.7; MGC111087; PERB11.1
Short Description N/A

GenWay Trust

Of course we value your privacy and your data security but most of all we value your trust.
Online Payments
GenWay Biotech Inc is a BBB Accredited Business. Click for the BBB Business Review of this Laboratories - Research & Development in San Diego CA