Details for Pancreatic Polypeptide Avian
Sequence (One Letter Code): GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH
Sequence: {GLY} {PRO} {SER} {GLN} {PRO} {THR} {TYR} {PRO} {GLY} {ASP} {ASP} {ALA} {PRO} {VAL} {GLU} {ASP} {LEU} {ILE} {ARG} {PHE} {TYR} {ASP} {ASN} {LEU} {GLN} {GLN} {TYR} {LEU} {ASN} {VAL} {VAL} {THR} {ARG} {HIS} {ARG} {TYR}-NH2 C Terminal: NH2
Formula: C190H283N53O58 Pancreatic Polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown. however. that Pancreatic Polypeptide affects the secretion of pancreatic enzymes. water. and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters. the colon. and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. Prolonged fasting. diabetes. and exercise can also increase PP levels. Serum PP levels can be elevated in as many as 50% of patients with carcinoid syndrome. Increased levels can also be found in patients with duodenal ulcers and in patients with type I diabetes. PP levels are often low in patients with pancreatic insufficiency or pancreatitis.
Function: Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.
Function: The physiological role for the icosapeptide has not yet been elucidated.
Subcellular Location: Secreted protein.
Similarity: Belongs to the NPY family. [1] Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,, et al.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences
[2] Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,, et al.
Direct Submission
[3] Boel E., Schwartz T.W., Norris K.E., Fiil N.P.
A cDNA encoding a small common precursor for human pancreatic polypeptide and pancreatic icosapeptide.
[4] Leiter A.B., Montminy M.R., Jamieson E., Goodman R.H.
Exons of the human pancreatic polypeptide gene define functional domains of the precursor.
[5] Leiter A.B., Keutmann H.T., Goodman R.H.
Structure of a precursor to human pancreatic polypeptide.
[6] Takeuchi T., Gumucio D.L., Yamada T., Meisler M.H., Minth C.D., Dixon J.E., Eddy R.E., Shows T.B.
Genes encoding pancreatic polypeptide and neuropeptide Y are on human chromosomes 17 and 7.
[7] Schwartz T.W., Hansen H.F., Haakanson R., Sundler F., Tager H.S.
Human pancreatic icosapeptide: isolation, sequence, and immunocytochemical localization of the COOH-terminal fragment of the pancreatic polypeptide precursor.
Sequence: {GLY} {PRO} {SER} {GLN} {PRO} {THR} {TYR} {PRO} {GLY} {ASP} {ASP} {ALA} {PRO} {VAL} {GLU} {ASP} {LEU} {ILE} {ARG} {PHE} {TYR} {ASP} {ASN} {LEU} {GLN} {GLN} {TYR} {LEU} {ASN} {VAL} {VAL} {THR} {ARG} {HIS} {ARG} {TYR}-NH2 C Terminal: NH2
Formula: C190H283N53O58 Pancreatic Polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown. however. that Pancreatic Polypeptide affects the secretion of pancreatic enzymes. water. and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters. the colon. and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. Prolonged fasting. diabetes. and exercise can also increase PP levels. Serum PP levels can be elevated in as many as 50% of patients with carcinoid syndrome. Increased levels can also be found in patients with duodenal ulcers and in patients with type I diabetes. PP levels are often low in patients with pancreatic insufficiency or pancreatitis.
Function: Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.
Function: The physiological role for the icosapeptide has not yet been elucidated.
Subcellular Location: Secreted protein.
Similarity: Belongs to the NPY family. [1] Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,, et al.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences
[2] Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,, et al.
Direct Submission
[3] Boel E., Schwartz T.W., Norris K.E., Fiil N.P.
A cDNA encoding a small common precursor for human pancreatic polypeptide and pancreatic icosapeptide.
[4] Leiter A.B., Montminy M.R., Jamieson E., Goodman R.H.
Exons of the human pancreatic polypeptide gene define functional domains of the precursor.
[5] Leiter A.B., Keutmann H.T., Goodman R.H.
Structure of a precursor to human pancreatic polypeptide.
[6] Takeuchi T., Gumucio D.L., Yamada T., Meisler M.H., Minth C.D., Dixon J.E., Eddy R.E., Shows T.B.
Genes encoding pancreatic polypeptide and neuropeptide Y are on human chromosomes 17 and 7.
[7] Schwartz T.W., Hansen H.F., Haakanson R., Sundler F., Tager H.S.
Human pancreatic icosapeptide: isolation, sequence, and immunocytochemical localization of the COOH-terminal fragment of the pancreatic polypeptide precursor.
Additional Info for Pancreatic Polypeptide Avian
| Name | Pancreatic Polypeptide Avian |
|---|---|
| Related Product Names | Pancreatic polypeptide; PP PNPPancreatic Polypeptide AvianPPY |
| NCBI Acc Number | AAH32225.1 |
| GI Number | 21594887 |
| Purity | > 95% |
| Stability | 6-12 months at -20 degree C. |
| Storage | 4 degree C for short term (weeks) and -20 degree C for long term. |
| Molecular Weight | 10445 |
| Sequence Length | 95 |
| Swiss Prot Number | P01298 |

