Pancreatic Polypeptide Avian

GenWay ID: GWB-680EB6
Legacy ID: 06-271-83395
Reactivity: Avian
purchase this item
$0.00

* Required Fields

Details for Pancreatic Polypeptide Avian

Sequence (One Letter Code): GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH

Sequence: {GLY} {PRO} {SER} {GLN} {PRO} {THR} {TYR} {PRO} {GLY} {ASP} {ASP} {ALA} {PRO} {VAL} {GLU} {ASP} {LEU} {ILE} {ARG} {PHE} {TYR} {ASP} {ASN} {LEU} {GLN} {GLN} {TYR} {LEU} {ASN} {VAL} {VAL} {THR} {ARG} {HIS} {ARG} {TYR}-NH2 C Terminal: NH2

Formula: C190H283N53O58 Pancreatic Polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown. however. that Pancreatic Polypeptide affects the secretion of pancreatic enzymes. water. and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters. the colon. and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. Prolonged fasting. diabetes. and exercise can also increase PP levels. Serum PP levels can be elevated in as many as 50% of patients with carcinoid syndrome. Increased levels can also be found in patients with duodenal ulcers and in patients with type I diabetes. PP levels are often low in patients with pancreatic insufficiency or pancreatitis.

Function: Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.

Function: The physiological role for the icosapeptide has not yet been elucidated.

Subcellular Location: Secreted protein.

Similarity: Belongs to the NPY family. [1] Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,, et al.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences
[2] Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,, et al.
Direct Submission
[3] Boel E., Schwartz T.W., Norris K.E., Fiil N.P.
A cDNA encoding a small common precursor for human pancreatic polypeptide and pancreatic icosapeptide.
[4] Leiter A.B., Montminy M.R., Jamieson E., Goodman R.H.
Exons of the human pancreatic polypeptide gene define functional domains of the precursor.
[5] Leiter A.B., Keutmann H.T., Goodman R.H.
Structure of a precursor to human pancreatic polypeptide.
[6] Takeuchi T., Gumucio D.L., Yamada T., Meisler M.H., Minth C.D., Dixon J.E., Eddy R.E., Shows T.B.
Genes encoding pancreatic polypeptide and neuropeptide Y are on human chromosomes 17 and 7.
[7] Schwartz T.W., Hansen H.F., Haakanson R., Sundler F., Tager H.S.
Human pancreatic icosapeptide: isolation, sequence, and immunocytochemical localization of the COOH-terminal fragment of the pancreatic polypeptide precursor.

Additional Info for Pancreatic Polypeptide Avian

Name Pancreatic Polypeptide Avian
Related Product Names Pancreatic polypeptide; PP PNPPancreatic Polypeptide AvianPPY
NCBI Acc Number AAH32225.1
GI Number 21594887
Purity > 95%
Stability 6-12 months at -20 degree C.
Storage 4 degree C for short term (weeks) and -20 degree C for long term.
Molecular Weight 10445
Sequence Length 95
Swiss Prot Number P01298

GenWay Trust

Of course we value your privacy and your data security but most of all we value your trust.
Online Payments
GenWay Biotech Inc is a BBB Accredited Business. Click for the BBB Business Review of this Laboratories - Research & Development in San Diego CA