GenWay Log In My Account My Cart
Home Products Services Technologies QC & QA Support Company News & Events
Alphabetical Listing of Primary Antibodies: f| 0-4 | 5-9 | A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | T | U | V | W | X | Y | Z |
Alphabetical Listing of Proteins: f| 0-4 | 5-9 | A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | T | U | V | W | X | Y | Z |
Peptides  |  Secondary Antibodies  |  ELISA Kits
HMGB1 Human recombinant protein Printer Friendly Datasheet
Catalog Number: 10-663-46237
Buy HMGB1 protein - Size:   
Trial Size Available
  Related Product Names:
- HMGB1 protein; HMGB1; HMG1; HMGB1 Human
- HMG1, HMG3, SBP-1, Amphoterin, HMGB1.; High mobility group protein 1; HMG-1; High mobility group protein B1
- Gene Information -
Information in yellow represents specific gene information and does not necessarily represent specific product details. For more information please contact sales@genwaybio.com.
 Gene Name: HMGB1  Gene Name Synonym: HMG1

 Gi #: N/A

 NCBI Acc #: NP_002119.1

 Swiss Prot Acc #: P09429

 Length (aa): N/A

 Mol. Weight (Da): 24894

 Chrom Location: N/A
 Amino Acid Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH

 Synonyms: HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1.

 Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

 Solubility: It is recommended to reconstitute the lyophilized HMGB1 in sterile 18M-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

 Introduction: High-mobility group box 1 protein (HMGB1), previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu.4, 5 Residues 27 - 43 and 178 - 184 contain a NLS. Posttranslational modifications of the molecule have been reported, with acetylation occurring on as many as 17 lysine residues. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins.

 Source/Host: E. Coli

 Purity/Purification: Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

 Format: The HMG1 was lyophilized after extensive dialyses against 1x PBS pH-7.4

 Stability: Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 C. Upon reconstitution HMGB1 should be stored at 4 C between 2-7 days and for future use below -18 C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

 Shipping: Products may be shipped on ice pack or dry ice.
 TESTING: (secondary reagents and protocols )
 Not Available
 HMGB1 PROTEIN TARGET DESCRIPTION:
Synonym Names for HMGB1 protein: HMGB1; HMG1; HMG1, HMG3, SBP-1, Amphoterin, HMGB1.; High mobility group protein 1; HMG-1; High mobility group protein B1

HMG1 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa.
The HMGB-1 is purified by proprietary chromatographic techniques.

High-mobility group box 1 protein (HMGB1), previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu.4, 5 Residues 27 - 43 and 178 - 184 contain a NLS. Posttranslational modifications of the molecule have been reported, with acetylation occurring on as many as 17 lysine residues. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins.

Function: Binds preferentially single-stranded DNA and unwinds double stranded DNA.

Subcellular Location: Nucleus.

Similarity: Belongs to the HMGB family.

Similarity: Contains 2 HMG box DNA-binding domains.

OMIM: 163905; gene. [NCBI / EBI]

Products similar to HMGB1 protein:
 IgG
    HMGB1 (high-mobility group box 1), IgG
    HMGB1 [HAP46.5], IgG
    HMG1L10 (high-mobility group (nonhistone chromosomal) protein 1-like 10), IgG
 PRODUCT INTERACTIONS:
 HMGB1 Human interacts with Cellular tumor antigen p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with Cellular tumor antigen p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 Human, Protein (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53M Human, Protein (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [SP5], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 phospho S15, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [DO-13], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [DO-7], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [Pab240], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [D01], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [3F301], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [DO-7] (ready-to-use), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [BP53-12], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with I-kappaB-alpha (Phospho-Ser32/Ser36), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (Phospho-Ser15), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (Phospho-Ser46), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (Phospho-Ser315), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (Ab-15), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (Ab-46), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (Ab-315), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (Phospho-Ser15) Antibody Blocking Peptide, Peptide (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (Phospho-Ser46) Antibody Blocking Peptide, Peptide (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (Phospho-Ser315) Antibody Blocking Peptide, Peptide (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with TP53 (tumor protein p53 (Li-Fraumeni syndrome)), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (a.a. 32-79), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (a.a. 88-109), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 (a.a. 306-393), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with Mouse p53, Wild Type, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with Human p53 Oncogene, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [B20.1 (BP 53.122)] antibody (ready-to-use), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 AIP1, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [BP53-12] (FITC), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [DO-2], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [DO-1], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with P53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [B20.1 (BP 53.122)] antibody (FITC), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with P53 [SP5] (ready-to-use), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [DO-1], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [B449], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [Pab240], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [Pab1801], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [Pab1801], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [D01], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53 [DO-2], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p53, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p73, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p73 delta N [38C674], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p73 alpha [SPM431], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p73 [5B429], IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p73 (Phospho-Tyr99), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p73 (Ab-99), IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p73 (Phospho-Tyr99) Antibody Blocking Peptide, Peptide (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p73, IgG (GenWay Catalog #: 10-663-46237).
 HMGB1 Human interacts with p73 alpha+beta [ER-15], IgG (GenWay Catalog #: 10-663-46237).
SUGGESTED PROTEIN REAGENTS - GenWay offers reagents to facilitate your research with cell-based assays, Mass Spectrometry, standards, calibrators, Western blot, cell culture, antibiotics, microwell substrates, and more!
Order Confirmation: Sales order confirmations are sent out upon the receipt of all orders. Please contact GenWay if you do not receive a confirmation within 1 business day of submitting your order.

Precautions: HMGB1 protein is for in vitro research use only. Not for use in diagnostics or therapeutic procedures.

Important Notes: During shipment, small volumes of HMGB1 protein vial. For products with volumes of 200 µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the container’s cap. Actual concentration, volume and quantity will be printed on the vial's label. Please refer to the vials label for this information.

Copyright: This GenWay TDS is copyrighted. This datasheet is produced based partially on data from Swiss-Prot/TrEMBL and NCBI. To better serve our clients with everything we know about HMGB1 protein, all related information, articles, resources about HMGB1 protein are being stored on our online database. Let us know if you have questions regarding this product.

Disclaimer: For documents and software available from this server, GenWay neither warrants nor assumes any legal liability or responsibility for the accuracy, completeness or utility of any information, product or process disclosed.

GenWay is a Protein and Antibody Solutions Provider. Customer Satisfaction is Our Top Priority.

GenWay has a diverse line of recombinant protein expression platforms, including E. coli expression, Bacliovirus expression, yeast expression, and mammalian expression. Combining the technologies of bioinformatics, protein domain analysis, gene codon optimization, protein fusion, and protein expression in different host cells, GenWay can produce soluble and functional proteins. In particular, GenWay has the capability and vector systems for expression of difficult proteins such as proteases, kinases, glycosylated and membrane proteins. We have a very high success rate (almost 100%) and can deliver the proteins in a timely fashion. This is a core competency necessary for efficient and effective production of immunogens and affinity ligands for antibody production and purification. GenWay has over 300

recombinant proteins

offered in our catalog.
Exact   |  Advanced Search

Select by Product Name
Prod Name: 
Products Type: 
IgG IgY
Protein Peptide
Applications: 
Source: 
Xreactivity: 
Conjugate: 
 
Specific Categories
Antibodies
Secondary Antibodies
Proteins
Custom Antibody
ELISA Kits
Reagents
Products by Pathway
Protein Expression
Cell Line Development
 
 
 
GenWay Biotech, Inc.  6777 Nancy Ridge Drive, San Diego, CA 92121
Tel: (858)458-0866  Fax: (858)458-0833  Email: sales@genwaybio.com
www.genwaybio.com ©1998 - 2010 GenWay Biotech, Inc. - All Rights Reserved