CRH peptide, Corticotropin Releasing Factor Human Rat peptide

Alphabetical Listing of Primary Antibodies:	f\| 0-4 \| 5-9 \| A \| B \| C \| D \| E \| F \| G \| H \| I \| J \| K \| L \| M \| N \| O \| P \| Q \| R \| S \| T \| U \| V \| W \| X \| Y \| Z \|
Alphabetical Listing of Proteins:	f\| 0-4 \| 5-9 \| A \| B \| C \| D \| E \| F \| G \| H \| I \| J \| K \| L \| M \| N \| O \| P \| Q \| R \| S \| T \| U \| V \| W \| X \| Y \| Z \|
Peptides \| Secondary Antibodies \| ELISA Kits

Corticotropin Releasing Factor Human Rat peptide

Catalog Number: 06-271-83167

Buy CRH peptide -

Size:

Related Product Names:

- CRH peptide; CRH; Corticotropin Releasing Factor Human Rat
- Corticotropin-releasing factor; CRF; Corticotropin-releasing hormone; Corticotropin releasing factor; Corticoliberin

- Gene Information - Information in yellow represents specific gene information and does not necessarily represent specific product details. For more information please contact sales@genwaybio.com.

Gene Name: CRH	Gene Name Synonym: N/A
Gi #: 35356	NCBI Acc #: CAA23834.1	Swiss Prot Acc #: P06850
Length (aa): 196	Mol. Weight (Da): 21422	Chrom Location: N/A

Sequence (One Letter Code): SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH

Sequence: {SER} {GLU} {GLU} {PRO} {PRO} {ILE} {SER} {LEU} {ASP} {LEU} {THR} {PHE} {HIS} {LEU} {LEU} {ARG} {GLU} {VAL} {LEU} {GLU} {MET} {ALA} {ARG} {ALA} {GLU} {GLN} {LEU} {ALA} {GLN} {GLN} {ALA} {HIS} {SER} {ASN} {ARG} {LYS} {LEU} {MET} {GLU} {ILE} {ILE}-NH2

C Terminal: NH2

Formula: C208H344N60O63S2

Solubility: Soluble in water (1 mg/ml). Clear and colorless.

Purity/Purification: > 95%

Crossreactivity: Human Rat

Storage: Store at -20C

Stability: 6-12 months at -20 degree C.

Shipping: Products may be shipped on ice pack or dry ice.

TESTING: (secondary reagents and protocols )

Not Available

CRH PEPTIDE TARGET DESCRIPTION:

Synonym Names for CRH peptide: CRH; Corticotropin-releasing factor; CRF; Corticotropin-releasing hormone; Corticotropin releasing factor; Corticoliberin

Corticotropin-releasing factor (CRF) has been widely implicated as playing a major role in modulating the endocrine. autonomic. behavioral and immune responses to stress. Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases adrenocorticotropic hormone (ACTH) and endorphin from the anterior pituitary. Corticotropin Releasing Factor (CRF) is also a neurotransmitter in the central nervous system. and is involved in autonomic and endocrine responses to stress.

Function: This hormone from hypothalamus regulates the release of corticotropin from pituitary gland.

Subcellular Location: Secreted protein.

Similarity: Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.

Corticotropin Releasing Factor Human Rat reacts with human rat.

OMIM: 122560; gene+phenotype. [NCBI / EBI]

Products similar to CRH peptide:

IgG

CRF, IgG

Corticotropin-releasing factor receptor 1, IgG

Corticotropin-releasing factor receptor 2, IgG

CRHR1 / CRF-R, IgG

CRHR2, IgG

Protein

Corticoliberin, Protein

CORTICOTROPHIN RELEASING FACTOR, Protein

Calcium-regulated heat stable protein 1, Protein

BACKGROUND REFERENCES for CRH PEPTIDE:

Background references for antibody target are not specific to GenWay products

[1] Shibahara,S., Morimoto,Y., Furutani,Y., Notake,M., Takahashi,H., Shimizu,S., Horikawa,S. and Numa,S.
     Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene
[2] Shibahara S., Morimoto Y., Furutani Y., Notake M., Takahashi H., Shimizu S., Horikawa S., Numa S.
     Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene.
[3] Robinson B.G., D'Angio L.A. Jr., Pasieka K.B., Majzoub J.A.
     Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing.
[4] Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., et al.
     Cloning of human full-length CDSs in BD Creator(TM) system donor vector.
[5] Sasaki A., Tempst P., Liotta A.S., Margioris A.N., Hood L.E., Kent S.B., Sato S., Shinkawa O., Yoshinaga K., Krieger D.T., et al.
     Isolation and characterization of a corticotropin-releasing hormone-like peptide from human placenta.
[6] Romier C., Bernassau J.-M., Cambillau C., Darbon H.
     Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics.

Order Confirmation: Sales order confirmations are sent out upon the receipt of all orders. Please contact GenWay if you do not receive a confirmation within 1 business day of submitting your order.

Precautions: CRH peptide is for in vitro research use only. Not for use in diagnostics or therapeutic procedures.

Important Notes: During shipment, small volumes of CRH peptide vial. For products with volumes of 200 µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the container’s cap. Actual concentration, volume and quantity will be printed on the vial's label. Please refer to the vials label for this information.

Copyright: This GenWay TDS is copyrighted. This datasheet is produced based partially on data from Swiss-Prot/TrEMBL and NCBI. To better serve our clients with everything we know about CRH peptide, all related information, articles, resources about CRH peptide are being stored on our online database. Let us know if you have questions regarding this product.

Disclaimer: For documents and software available from this server, GenWay neither warrants nor assumes any legal liability or responsibility for the accuracy, completeness or utility of any information, product or process disclosed.

GenWay is a Protein and Antibody Solutions Provider. Customer Satisfaction is Our Top Priority.



GenWay Biotech, Inc. 6777 Nancy Ridge Drive, San Diego, CA 92121 Tel: (858)458-0866 Fax: (858)458-0833 Email: sales@genwaybio.com www.genwaybio.com ©1998 - 2010 GenWay Biotech, Inc. - All Rights Reserved