GRP peptide, Gastrin Releasing Peptide Porcine peptide

Alphabetical Listing of Primary Antibodies:	f\| 0-4 \| 5-9 \| A \| B \| C \| D \| E \| F \| G \| H \| I \| J \| K \| L \| M \| N \| O \| P \| Q \| R \| S \| T \| U \| V \| W \| X \| Y \| Z \|
Alphabetical Listing of Proteins:	f\| 0-4 \| 5-9 \| A \| B \| C \| D \| E \| F \| G \| H \| I \| J \| K \| L \| M \| N \| O \| P \| Q \| R \| S \| T \| U \| V \| W \| X \| Y \| Z \|
Peptides \| Secondary Antibodies \| ELISA Kits

Gastrin Releasing Peptide Porcine peptide

Catalog Number: 06-271-83233

Buy GRP peptide -

Size:

Related Product Names:

- GRP peptide; GRP; Gastrin Releasing Peptide Porcine
- GRP; Proventricular peptide; Gastrin-releasing peptide (GRP) (Proventricular peptide) [Contains: Neuromedin C (GRP-10)]; Gastrin-releasing peptide

- Gene Information - Information in yellow represents specific gene information and does not necessarily represent specific product details. For more information please contact sales@genwaybio.com.

Gene Name: GRP	Gene Name Synonym: N/A
Gi #: 121643	NCBI Acc #: P01295	Swiss Prot Acc #: P01295
Length (aa): 27	Mol. Weight (Da): 2842	Chrom Location: N/A

Sequence (One Letter Code): APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2

Sequence: {ALA} {PRO} {VAL} {SER} {VAL} {GLY} {GLY} {GLY} {THR} {VAL} {LEU} {ALA} {LYS} {MET} {TYR} {PRO} {ARG} {GLY} {ASN} {HIS} {TRP} {ALA} {VAL} {GLY} {HIS} {LEU} {MET}

C Terminal: NH2

Formula: C126H198N38O31S2

Solubility: Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Purity/Purification: > 95%

Crossreactivity: Porcine

Storage: Store at -20C. Keep tightly closed. Store at a cool dry place.

Stability: 6-12 months at -20 degree C.

Shipping: Products may be shipped on ice pack or dry ice.

TESTING: (secondary reagents and protocols )

Not Available

GRP PEPTIDE TARGET DESCRIPTION:

Synonym Names for GRP peptide: GRP; GRP; Proventricular peptide; Gastrin-releasing peptide (GRP) (Proventricular peptide) [Contains: Neuromedin C (GRP-10)]; Gastrin-releasing peptide

Gastrin Releasing Peptide (GRP) is released by the post-ganglionic fibres of the vagus nerve which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumour marker in the diagnosis of small-cell lung carcinoma.

Function: GRP stimulates gastrin release as well as other gastrointestinal hormones.

Subcellular Location: Secreted protein.

Similarity: Belongs to the bombesin/neuromedin B/ranatensin family.

Gastrin Releasing Peptide Porcine reacts with porcine.

Products similar to GRP peptide:

IgG

HSP90B1 (heat shock protein 90kDa beta (Grp94). member 1), IgG

Procalcitonin [6F10], IgG

PGRP-L (45G1), IgG

Cytohesin 3 [CYT3-10], IgG

Calcitonin [14A2 ], IgG

Peptide

AGRP (87-132) Human, Peptide

Calcitonin gene-related peptide-receptor component protein, Protein

Dnak SBD C-terminus E.Coli, Protein

AGRP Human, Protein

Growth arrest and DNA-damage-inducible protein GADD45 gamma, Protein

BACKGROUND REFERENCES for GRP PEPTIDE:

Background references for antibody target are not specific to GenWay products

[1] McDonald,T.J., Jornvall,H., Ghatei,M., Bloom,S.R. and Mutt,V., et al.
     Characterization of an avian gastric (proventricular) peptide having sequence homology with the porcine gastrin-releasing peptide and the amphibian peptides bombesin and alytesin
[2] Campbell,B.J., Young,J., Dimaline,R. and Dockray,G.J., et al.
     Isolation, sequence and biosynthetic significance of a novel fragment of gastrin-releasing peptide from chicken proventriculus
[3] McDonald T.J., Joernvall H., Ghatei M., Bloom S.R., Mutt V.
     Characterization of an avian gastric (proventricular) peptide having sequence homology with the porcine gastrin-releasing peptide and the amphibian peptides bombesin and alytesin.
[4] Campbell B.J., Young J., Dimaline R., Dockray G.J.
     Isolation, sequence and biosynthetic significance of a novel fragment of gastrin-releasing peptide from chicken proventriculus.

Order Confirmation: Sales order confirmations are sent out upon the receipt of all orders. Please contact GenWay if you do not receive a confirmation within 1 business day of submitting your order.

Precautions: GRP peptide is for in vitro research use only. Not for use in diagnostics or therapeutic procedures.

Important Notes: During shipment, small volumes of GRP peptide vial. For products with volumes of 200 µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the container’s cap. Actual concentration, volume and quantity will be printed on the vial's label. Please refer to the vials label for this information.

Copyright: This GenWay TDS is copyrighted. This datasheet is produced based partially on data from Swiss-Prot/TrEMBL and NCBI. To better serve our clients with everything we know about GRP peptide, all related information, articles, resources about GRP peptide are being stored on our online database. Let us know if you have questions regarding this product.

Disclaimer: For documents and software available from this server, GenWay neither warrants nor assumes any legal liability or responsibility for the accuracy, completeness or utility of any information, product or process disclosed.

GenWay is a Protein and Antibody Solutions Provider. Customer Satisfaction is Our Top Priority.



GenWay Biotech, Inc. 6777 Nancy Ridge Drive, San Diego, CA 92121 Tel: (858)458-0866 Fax: (858)458-0833 Email: sales@genwaybio.com www.genwaybio.com ©1998 - 2010 GenWay Biotech, Inc. - All Rights Reserved