Recombinant Human β-NGF

GWB-BIG0E8

$0.00
Add to Cart

Description

Description: ?-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. ?-NGF is a potent neurotrophic factor that signals through its receptor ?-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. ?-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. The functional form of human ?-NGF is a noncovalently disulfide-linked homodimer, of two 13.5 kDa polypeptide monomers (240 total amino acid residues). The three disulfide bonds are required for biological activity.

Sequence: SSSHPIFHRG EFSVCDSVSV WVGDKTTATD IKGKEVMVLG EVNINNSVFK QYFFETKCRD PNPVDSGCRG IDSKHWNSYC TTTHTFVKAL TMDGKQAAWR FIRIDTACVC VLSRKAVRRA

Additional Information

Name Recombinant Human β-NGF
Related Product Names NGF-β
Gene Symbol NGF
Gene Fullname nerve growth factor
Gene id 4803
Alias Symbols NGF-beta
Protein Name beta-nerve growth factor
Description of Target beta-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. beta-NGF is a potent neurotrophic factor that signals through its rec
Swissprot ID P01138
Protein Accession Num NP_002497.2
Nucleotide Accession Nucleotide Accession NumNum NM_002506.2
Species Reactivity Human, Chicken, Hamster, Mouse, Rat
Host E. Coli
Purity 98% Verified by UV Spectroscopy and/or SDS-PAGE gel.
Protein Sequence Synthetic peptide located within the following region:
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Reconstitution and Storage Store at -20C. Avoid freeze/thaw cycles.
Sequence Length SSSHPIFHRG EFSVCDSVSV WVGDKTTATD IKGKEVMVLG EVNINNSVFK QYFFETKCRD PNPVDSGCRG IDSKHWNSYC TTTHTFVKAL TMDGKQAAWR FIRIDTACVC VLSRKAVRRA
Storage -20°C
Intended Use Research Use Only
Additional Information Verified by N-terminal and Mass Spectrometry analyses (when applicable).
Endotoxin level is <0.1 ng/ug of protein (<1EU/ug).
:: Biological Activity: determined by its ability to stimulate chick E9 DRG neurite outgrowth. The ED50 is <= 1.0 ng/ml, corresponding to a specific activity of >= 1 x 106 units/mg.