Web Analytics

AIP Antibody

GWB-53FC53

18-003-43454

0.1 mg
$264.60
Add to Cart

Description

AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein.AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein.

Additional Information

Name AIP Antibody
Related Product Names ARA9; XAP2; XAP-2; FKBP16; FKBP37; SMTPHN
Immunogen Synthetic Peptide within the following region: VAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIF
Immunogen Species Human
NCBI Acc Number NP_003968.1
Molecular Weight 38kDa
Datasheets / Downloads GWB-53FC53 Datasheet
Swiss Prot Number O00170
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Applications WB, IHC
GI Number 4502009
Clonality Polyclonal
Format Lyophilized powder. Add 100 ul of distilled water. Final anti-AIP antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Reactivity Bovine, Dog, Horse, Human, Mouse, Rat, Zebrafish
Sequence Length 330
Storage For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
Intended Use Research Use Only