TAF1A Antibody

GWB-102C3C

18-003-43015

100 ul
$332.10
Add to Cart

Description

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1A encodes the smallest SL1-specific TAF.

Additional Information

Name TAF1A Antibody
Availability In Stock
Related Product Names SL1; RAFI48; TAFI48; MGC:17061
Swissprot ID Q9NWA1
Immunogen Synthetic Peptide within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL
Immunogen Species Human
NCBI Acc Number NP_647603.1
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 40kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit Ig G is purified by peptide affinity chromatography method.
Source Rabbit
Application IHC, WB
GI Number 21536362
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Sequence Length 336
Datasheets/Manuals Printable datasheet for GWB-102C3C
Intended Use Research Use Only