TWIST1 Antibody (GWB-D1A2ED) (Aviva Cat. No. ARP37997_T100)

This exact product is available to purchase through Aviva Systems Biology.
Please see item number ARP37997_T100 to view product details and for ordering information.


GWB-D1A2ED

Aviva Cat. No.: ARP37997_T100

18-003-44055

Description

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation.TWIST1 is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome.

Additional Information

Name TWIST1 Antibody (GWB-D1A2ED)
Related Product Names SCS; ACS3; CRS1; BPES2; BPES3; TWIST; bHLHa38
Swissprot ID Q15672
Immunogen Synthetic Peptide within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW
Immunogen Species Human
NCBI Acc Number NP_000465.1
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 21kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Application WB, IHC
GI Number 4507741
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Horse, Pig, Rat, Zebrafish
Sequence Length 202
Datasheets/Manuals Printable datasheet for GWB-D1A2ED
Intended Use Research Use Only