AREB6 Antibody

0.1 mg
Add to Cart

* Required Fields


Transcription Factor AREB6 / transcription factor 8 /zinc finger homeodomain enhancer-binding protein inhibits interleukin-2 (IL-2) gene expression. May be responsible for transcriptional repression of the IL-2 gene. Enhances or represses the promoter act

Additional Information

Name AREB6 Antibody
Related Product Names AREB6; BZP; MGC133261; NIL-2-A; NIL-2A; TCF8; ZEB; ZFHEP; ZFHX1A; FECD6; NIL2A; PPCD3; DELTAEF1
Immunogen Synthetic Peptide within the following region: YNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPGRS
Immunogen Species Human
Intended Use Research Use Only
NCBI Acc Number NP_110378.2
GI Number 28077091
Purity Rabbit Ig G is purified by Protein G/A affinity chromatography method.
Format Lyophilized powder. Add 100 ul of distilled water. Final anti-AREB6 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Clonality Polyclonal
Storage For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
Molecular Weight 124kDa
Sequence Length 1124
Swiss Prot Number P37275
Applications WB