Description
Cdk7 is the catalytic subunit of the CDK-activating kinase (CAK) complex, a serine-threonine kinase. CAK activates the cyclin-associated kinases CDC2/CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcripti
Additional Information
Name | CDK7 Antibody (GWB-5CCA1B) |
---|---|
Related Product Names | CAK1; CDKN7; MO15; STK1; p39MO15; HCAK |
Swissprot ID | P50613 |
Immunogen | Synthetic Peptide within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Immunogen Species | Human |
NCBI Acc Number | NP_001790.1 |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Molecular Weight | 39kDa |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml. |
Purity | Rabbit Ig G is purified by Protein G/A affinity chromatography method. |
Source | Rabbit |
Application | WB, IHC |
GI Number | 4502743 |
Clonality | Polyclonal |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Reactivity | Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rat |
Sequence Length | 346 |
Datasheets/Manuals | Printable datasheet for GWB-5CCA1B |
Intended Use | Research Use Only |