GJA1 Antibody (GWB-4FBEB8)

GWB-4FBEB8

18-003-42804

100 ul
$332.10
Add to Cart

Description

Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. Connexin 43 is targeted by several protein kinases that regulate myocardial cell-cell coupling. A related intron-less connexin 43 pseudogene, GJA1P, has been mapped to chromosome 5.

Additional Information

Name GJA1 Antibody (GWB-4FBEB8)
Availability In Stock
Related Product Names HSS; CX43; GJAL; ODDD; AVSD3; HLHS1; DFNB38
Swissprot ID Q53FJ6
Immunogen Synthetic Peptide within the following region: LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE
Immunogen Species Human
NCBI Acc Number NP_000156.1
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 42kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit Ig G is purified by peptide affinity chromatography method.
Source Rabbit
Application WB
GI Number 4504001
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Guinea pig, Human, Mouse, Pig, Rabbit
Sequence Length 382
Datasheets/Manuals Printable datasheet for GWB-4FBEB8
Intended Use Research Use Only