Product Datasheet: GWB-5CCA1B - CDK7 Antibody (GWB-5CCA1B) - Genway Biotech
 
CDK7 Antibody (GWB-5CCA1B)
Data Sheet
 
Product Number GWB-5CCA1B
Product Page www.genwaybio.com/cdk7-cyclin-dependent-kinase-7-mo15-homolog-xenopus-laevis-cdk-activating-kinase
Name CDK7 Antibody (GWB-5CCA1B)
Source Rabbit
Reactivity Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rat
Size 100 ul
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Related Product Names (Synonyms) CAK1; CDKN7; MO15; STK1; p39MO15; HCAK
Molecular Weight 39kDa
Sequence Length 346
GI Number 4502743
NCBI Acc Number NP_001790.1
Purity Rabbit Ig G is purified by Protein G/A affinity chromatography method.
Clonality Polyclonal
Immunogen Species Human
Intended Use Research Use Only
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description Cdk7 is the catalytic subunit of the CDK-activating kinase (CAK) complex, a serine-threonine kinase. CAK activates the cyclin-associated kinases CDC2/CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcripti
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Swissprot Id P50613
Datasheets/Manuals Printable datasheet for GWB-5CCA1B
Notice This exact product is available to purchase through Aviva Systems Biology.
Please see item number AVARP03009_T100 to view product details and for ordering information.
Immunogen Synthetic Peptide within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Application WB, IHC
 

Genway Biotech manufactures and sells quality antibody products covering genome wide proteins.

GENWAY BIOTECH
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)458-0866 | sales@genwaybio.com