MICA Antibody

0.1 mg
Add to Cart

* Required Fields


MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.

Additional Information

Name MICA Antibody
Related Product Names DAQB-48K1.7; MGC111087; PERB11.1
Immunogen Synthetic Peptide within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT
Immunogen Species Human
Intended Use Research Use Only
NCBI Acc Number NP_000238.1
GI Number 4557751
Purity Rabbit IgG purified by protein A chromatography.
Format Lyophilized powder. Add 100 ul of distilled water. Final anti-MICA antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Clonality Polyclonal
Storage For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
Molecular Weight 42kDa
Sequence Length 383
Applications WB