Web Analytics

In observance of Memorial Day, Genway Biotech office will be closed on Monday, May 28th, 2018

BNP (1-32) Human

GWB-115105

06-271-83120

0.5 mg
$210.80
Add to Cart

Description

Sequence (One Letter Code): SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)

Sequence: {SER} {PRO} {LYS} {MET} {VAL} {GLN} {GLY} {SER} {GLY} {CYS} {PHE} {GLY} {ARG} {LYS} {MET} {ASP} {ARG} {ILE} {SER} {SER} {SER} {SER} {GLY} {LEU} {GLY} {CYS} {LYS} {VAL} {LEU} {ARG} {ARG} {HIS}

Formula: C143H244N50O42S4

Chemical Bridge: Disulfide bridge: Cys10-Cys26

Solubility: Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. Brain Natriuretic Peptide (type B natriuretic peptide. BNP) was originally isolated from brain. but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. BNP is involved in blood pressure control and cardiovascular homeostasis.

N/A [1] Hama,A. and Honda,H., et al.
p40BBP, BINP-binding protein
[2] Hama,T. and Honda,Y., et al.
Direct Submission
[3] Hama A., Honda H.
Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases.
[4] Hama T., Honda Y.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases.

Additional Information

Name BNP (1-32) Human
Related Product Names 2310037P21Rik; mbbpBNP (1-32) HumanTmem158
NCBI Acc Number BAD27475.1
Molecular Weight 3464.1
Datasheets / Downloads GWB-115105 Datasheet
Swiss Prot Number Q6F5E0
Purity > 95%
GI Number 50080115
Reactivity Human
Sequence Length 286
Storage Store the peptide at -20C.
Intended Use Research Use Only