Secretoneurin Rat

GWB-13CBE7

06-271-83461

0.2 mg
$221.60
Add to Cart

Description

Sequence (One Letter Code): TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ

Sequence: {THR} {ASN} {GLU} {ILE} {VAL} {GLU} {GLU} {GLN} {TYR} {THR} {PRO} {GLN} {SER} {LEU} {ALA} {THR} {LEU} {GLU} {SER} {VAL} {PHE} {GLN} {GLU} {LEU} {GLY} {LYS} {LEU} {THR} {GLY} {PRO} {SER} {ASN} {GLN} Solubility: Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. Secretoneurin (Rat) is a neuropeptide generated in brain. adrenal medulla and other endocrine tissues by proteolytic processing of Secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release.

Function: Secretogranin-2 is a neuroendocrine secretory granule protein, which is the precursor for biologically active peptides.

Subcellular Location: Neuroendocrine and endocrine secretory granules.

Miscellaneous: Binds calcium with a low-affinity.

Similarity: Belongs to the chromogranin/secretogranin protein family. [1] Gerdes,H.H., Phillips,E. and Huttner,W.B., et al.
The primary structure of rat secretogranin II deduced from a cDNA sequence
[2] Kakar,S.S., Wei,N., Mulchahey,J.J., LeBoeuf,R.D. and Neill,J.D., et al.
Regulation of expression of secretogranin II mRNA in female rat pituitary and hypothalamus
[3] Leitner,B., Schneitler,C., Klocker,H., Volknandt,W., Zimmermann,H., Winkler,H. and Fischer-Colbrie,R.
Formation and sequence analysis of secretoneurin, a neuropeptide derived from secretogranin II, in mammalian, bird, reptile, amphibian and fish brains
[4] Gerdes H.-H., Philipps E., Huttner W.B.
The primary structure of rat secretogranin II deduced from a cDNA sequence.
[5] Kakar S.S., Wei N., Mulchahey J.J., Leboeuf R.D., Neill J.D.
Regulation of expression of secretogranin II mRNA in female rat pituitary and hypothalamus.
[6] Leitner B., Schneitler C., Klocker H., Volknandt W., Zimmermann H., Winkler H., Fischer-Colbrie R.
Formation and sequence analysis of secretoneurin, a neuropeptide derived from secretogranin II, in mammalian, bird, reptile, amphibian and fish brains.

Additional Information

Name Secretoneurin Rat
Related Product Names Secretogranin II; SgII; Chromogranin C Chgc; Scg-2Secretoneurin RatScg2
NCBI Acc Number P10362
Molecular Weight 71031
Datasheets / Downloads GWB-13CBE7 Datasheet
Swiss Prot Number P10362
Purity > 95%
GI Number 134465
Stability 6-12 months at -20 degree C.
Reactivity Rat
Sequence Length 619
Storage 4 degree C for short term (weeks) and -20 degree C for long term.
Intended Use Research Use Only