Recombinant Human Adiponectin Globular (GWB-3D9CC8)

GWB-3D9CC8

10-663-46539

$0.00
Add to Cart

Description

Sequence: MKG E PG E G A YVYRS A FSVGL E TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYF A YHITVYMKDVKVSLFKKDK A MLFTYDQYQ E NNVDQ A SGSVLLHL E VGDQVWLQVYG E G E RNGLY A DNDNDSTFTGFLLYHDTN.

Solubility: We recommended reconstituting gAcrp30 at a concentration of 0.1-1mg per ml with 5mM Tris pH-8 and 0.75mM DTT which can then be further diluted to other aqueous solutions. Introduction gAcrp30 globular protein, exists as a result of proteolytic processing of adiponectin. Adiponectin is manufactured and secreted solely by adipocytes, and is a highly obtained plasma protein, accounting for up to 0.05% of total serum protein. Similar to Adiponectin, gAcrp30 is able of lowering hyperglycemia and reversing insulin resistance. In addition, gAcrp30 is an significant protein that is involved in promoting fat loss by signaling muscle to absorb and burn Free-Fatty Acids. AdipoR1 & AdipoR2 are the 2 signaling receptors for adiponectin and gAcrp30 that were recently been identified.Description gAcrp30 Human Recombinant produced in E.Coli is a homodimeric, non-glycosylated, Polypeptide chain containing 145 amino acids and having a molecular mass of 16690 Dalton. The gAcrp30 is purified by proprietary chromatographic techniques.

Additional Information

Name Recombinant Human Adiponectin Globular (GWB-3D9CC8)
Availability In Stock
Related Product Names gAcrp30, Globular Adiponectin Recombinant, Acrp30, AdipoQ, GBP-28, APM-1, ACDC Recombinant Human Adiponectin GlobulargAcrp30
Gene Symbol gAcrp30
Gene id 9370
Alias Symbols Acrp30, AdipoQ, GBP-28, APM-1, ACDC, gAcrp30 Human, Globular Adiponectin Human Recombinant
Swissprot ID Q15848
Protein Name Adiponectin
Description of Target Recombinant Human Adiponectin Globular
Protein Accession Num NP_001171271.1
Host E. Coli
Peptide Sequence MKGEPGEGAY VYRSAFSVGL ETYVTIPNMP IRFTKIFYNQ QNHYDGSTGK FHCNIPGLYY FAYHITVYMK DVKVSLFKKD KAMLFTYDQY QENNVDQASG SVLLHLEVGD QVWLQVYGEG ERNGLYADND NDSTFTGFLL YHDTN.
Product Format Sterile filtered and lyophilized from 1mg/ml in 10mM Tris pH-8 & 0.75mM DTT.
Purity Greater than 97% as determined by HPLC and SDS PAGE.
Format Sterile filtered and lyophilized from 1mg/ml in 10mM Tris pH-8 & 0.75mM DTT.
Reconstitution and Storage For long term, store lyophilized protein at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4C for a limited period of time two weeks.
Storage For long term, store lyophilized protein at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4C for a limited period of time two weeks.
Datasheets/Manuals Printable datasheet for GWB-3D9CC8
Intended Use Research Use Only
Additional Information Solubility: We recommended reconstituting gAcrp30 at a concentration of 0.1-1mg per ml with 5mM Tris pH-8 and 0.75mM DTT which can then be further diluted to other aqueous solutions.
:: Biological Activity: gAcrp30 activity is determined by its ability to inhibit the proliferation of mouse M1 cells. The expected ED50 for this effect is 1.0 - 2.5 ug/ml.
:: Product Introduction: gAcrp30 globular protein, exists as a result of proteolytic processing of adiponectin. Adiponectin is manufactured and secreted solely by adipocytes, and is a highly obtained plasma protein, accounting for up to 0.05% of total serum protein. Similar to Adiponectin, gAcrp30 is able of lowering hyperglycemia and reversing insulin resistance. In addition, gAcrp30 is an significant protein that is involved in promoting fat loss by signaling muscle to absorb and burn Free-Fatty Acids. AdipoR1 & AdipoR2 are the 2 signaling receptors for adiponectin and gAcrp30 that were recently been identified.
Product Description: gAcrp30 Human Recombinant produced in E.Coli is a homodimeric, non-glycosylated, Polypeptide chain containing 145 amino acids and having a molecular mass of 16690 Dalton. The gAcrp30 is purified by proprietary chromatographic techniques.