Recombinant Porcine Adiponectin glycosilated HEK (GWB-76F876)

GWB-76F876

10-663-46877

$0.00
Add to Cart

Description

Sequence: HVDYKDDDDKP A G E TT E KPG A LLPMPKG A C A GWM A GIPGHPGHNGTPGRDGRDGVPG E KG E KGDTGLTGPKGDTG E SGVTGV E GPRGFPGIPGRKG E PG E S A YVYRS A FSVGL E TRVTVPNMPIRFTKIFYNQQNHYDVTTGKFHCNIPGLYYFSFHITVLKDVKVSLYKDK A VLFTYDQQDKNVDQ A SGVLLYL E KGDQWLQ A YGD E E NGVY A DNVNDSFTGFLLYHNI E

Solubility: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Introduction Adiponectin is a recently discovered 244 amino acid protein, the product of the apM1 gene, which is physiologically active and specifically and highly expressed in adipose cells (Adipokine). The protein belongs to the soluble defense collagen super family; it has a collagen-like domain structurally homologous with collagen VIII and X and complement factor C1q-like globular domain. APM-1 forms homotrimers, which are the building blocks for higher order complexes found circulating in serum.Description The Acrp30 Porcine Recombinant contains a total of 238 amino acids having a molecular Mass of 26kDa. The Porcine Adiponectin is fused to a 13 amino acid long N-terminal FLAG tag.

Additional Information

Name Recombinant Porcine Adiponectin glycosilated HEK (GWB-76F876)
Availability In Stock
Related Product Names Acrp30 Porcine, HEK, Adiponectin Porcine Recombinant, HEK derived, Acrp30, AdipoQ, GBP-28, APM-1, ACDC Recombinant Porcine Adiponectin glycosilated, HEKpAcrp30 HEK
Gene Symbol pAcrp30 HEK
Alias Symbols Acrp30, AdipoQ, GBP-28, APM-1, ACDC, Acrp30 Porcine, HEK, Adiponectin Porcine Recombinant, HEK derived
Description of Target Recombinant Porcine Adiponectin glycosilated, HEK
Host HEK293 (Human Embryonic Kidney Cell Line)
Peptide Sequence HVDYKDDDDK PAGETTEKPG ALLPMPKGAC AGWMAGIPGH PGHNGTPGRD GRDGVPGEKG EKGDTGLTGP KGDTGESGVT GVEGPRGFPG IPGRKGEPGE SAYVYRSAFS VGLETRVTVP NMPIRFTKIF YNQQNHYDVT TGKFHCNIPG LYYFSFHITV LKDVKVSLYK DKAVLFTYDQ QDKNVDQASG VLLYLEKGDQ WLQAYGDEEN GVYADNVNDS FTGFLLYHNIE.
Product Format Sterile filtered and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl pH-7.5.
Purity Greater than 90% as determined by SDS PAGE.
Application WB
Format Sterile filtered and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl pH-7.5.
Reconstitution and Storage For long term, store lyophilized AdipoQ at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4C for a limited period of time; it does not show any change after two weeks at 4C. The lyophilized protein remains stable for 24 months when stored at -20C.
Storage For long term, store lyophilized AdipoQ at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4C for a limited period of time; it does not show any change after two weeks at 4C.
Datasheets/Manuals Printable datasheet for GWB-76F876
Intended Use Research Use Only
Additional Information Solubility: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely.
:: Product Introduction: Adiponectin is a recently discovered 244 amino acid protein, the product of the apM1 gene, which is physiologically active and specifically and highly expressed in adipose cells (Adipokine). The protein belongs to the soluble defense collagen super family; it has a collagen-like domain structurally homologous with collagen VIII and X and complement factor C1q-like globular domain. APM-1 forms homotrimers, which are the building blocks for higher order complexes found circulating in serum.
Product Description: The Acrp30 Porcine Recombinant contains a total of 238 amino acids having a molecular Mass of 26kDa. The Porcine Adiponectin is fused to a 13 amino acid long N-terminal FLAG tag.