AGRP (87-132) Human (GWB-A81F54)

GWB-A81F54

06-271-83052

$0.00
Add to Cart

Description

Sequence (One Letter Code): CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Sequence: {CYS} {VAL} {ARG} {LEU} {HIS} {GLU} {SER} {CYS} {LEU} {GLY} {GLN} {GLN} {VAL} {PRO} {CYS} {CYS} {ASP} {PRO} {CYS} {ALA} {THR} {CYS} {TYR} {CYS} {ARG} {PHE} {PHE} {ASN} {ALA} {PHE} {CYS} {TYR} {CYS} {ARG} {LYS} {LEU} {GLY} {THR} {ALA} {MET} {ASN} {PRO} {CYS} {SER} {ARG} {THR} Chemical Bridge: 87-102. 94-108. 101-119. 105-129 and 110- 117 The cysteine-rich C-terminal domain of AGRP. corresponding to AGRP(87-132). it exhibits receptor binding affinity and antagonism equivalent to that of the full-length protein. Acting as a competitive antagonist. AGRP(83-132) acts orthosterically at the MC4-R to inhibit Gs-coupled accumulation of intracellular cAMP.

Function: Plays a role in weight homeostasis. May play a role in the regulation of melanocortin receptors within the hypothalamus and adrenal gland, and therefore in the central control of feeding.

Subcellular Location: Secreted protein (By similarity).

Tissue Specificity: Expressed primarily in the adrenal gland, subthalamic nucleus, and hypothalamus, with a lower level of expression occurring in testis, lung, and kidney.

Disease: Defects in AGRP may be a cause of autosomal dominant obesity [MIM:601665].

Similarity: Contains 1 agouti domain. [1] Vink,T., Hinney,A., van Elburg,A.A., van Goozen,S.H., Sandkuijl,L.A., Sinke,R.J., Herpertz-Dahlmann,B.M., Hebebrand,J.,, et al.
Association between an agouti-related protein gene polymorphism and anorexia nervosa
[2] Vink,T., et al.
Direct Submission
[3] Shutter J.R., Graham M., Kinsey A.C., Scully S., Luethy R., Stark K.L.
Hypothalamic expression of ART, a novel gene related to agouti, is up-regulated in obese and diabetic mutant mice.
[4] Ollmann M.M., Wilson B.D., Yang Y.K., Kerns J.A., Chen Y., Gantz I., Barsh G.S.
Antagonism of central melanocortin receptors in vitro and in vivo by agouti-related protein.
[5] Brown A.M., Mayfield D.K., Volaufova J., Argyropoulos G.
The gene structure and minimal promoter of the human agouti related protein.
[6] Vink T., Hinney A., van Elburg A.A., van Goozen S.H., Sandkuijl L.A., Sinke R.J., Herpertz-Dahlmann B.M., Hebebrand J., Remschmidt H., van Engeland H., et al.
Association between an agouti-related protein gene polymorphism and anorexia nervosa.
[7] Rieder M.J., Johanson E.J., da Ponte S.H., Hastings N.C., Ahearn M.O., Bertucci C.B., Wong M.W., Yi Q., Nickerson D.A.
SeattleSNPs. NHLBI HL66682 program for genomic applications, UW-FHCRC, Seattle, WA (URL: http://pga.gs.washington.edu).
[8] Bures E.J., Hui J.O., Young Y., Chow D.T., Katta V., Rohde M.F., Zeni L., Rosenfeld R.D., Stark K.L., Haniu M., et al.
Determination of disulfide structure in agouti-related protein (AGRP) by stepwise reduction and alkylation.
[9] Bolin K.A., Anderson D.J., Trulson J.A., Thompson D.A., Wilken J., Kent S.B.H., Gantz I., Millhauser G.L.
NMR structure of a minimized human agouti related protein prepared by total chemical synthesis.
[10] Jackson P.J., McNulty J.C., Yang Y.K., Thompson D.A., Chai B., Gantz I., Barsh G.S., Millhauser G.L.
Design, pharmacology, and NMR structure of a minimized cystine knot with agouti-related protein activity.

Additional Information

Name AGRP (87-132) Human (GWB-A81F54)
Availability In Stock
Related Product Names AGRT; ARTAGRP (87-132) HumanAGRP
Swissprot ID O00253
NCBI Acc Number AAK96256.1
Molecular Weight 14440
Purity > 95%
GI Number 15384342
Stability 6-12 months at -20 degree C.
Reactivity Human
Sequence Length 132
Storage 4 degree C for short term (weeks) and -20 degree C for long term.
Datasheets/Manuals Printable datasheet for GWB-A81F54
Intended Use Research Use Only