ACSL1 Antibody

GWB-DFB0FA

18-003-42285

100 ul
$332.10
Add to Cart

Description

ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Additional Information

Name ACSL1 Antibody
Related Product Names ACS1; FACL1; FACL2; LACS; LACS1; LACS2
Swissprot ID P33121
Immunogen Synthetic Peptide within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
Immunogen Species Human
NCBI Acc Number NP_001986.2
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 78kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit Ig G is purified by peptide affinity chromatography method.
Source Rabbit
Applications WB, IHC
GI Number 40807491
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rat
Sequence Length 698
Datasheets/Manuals Printable datasheet for GWB-DFB0FA
Intended Use Research Use Only