Neuropeptide Y Human (GWB-282F1B)

GWB-282F1B

06-271-83356

$0.00
Add to Cart

Description

Sequence (One Letter Code): YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH

Sequence: {TYR} {PRO} {SER} {LYS} {PRO} {ASP} {ASN} {PRO} {GLY} {GLU} {ASP} {ALA} {PRO} {ALA} {GLU} {ASP} {MET} {ALA} {ARG} {TYR} {TYR} {SER} {ALA} {LEU} {ARG} {HIS} {TYR} {ILE} {ASN} {LEU} {ILE} {THR} {ARG} {GLN} {ARG} {TYR}-NH2 C Terminal: NH2

Formula: C189H285N55O57S1

Solubility: The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. Solvent: 1mg/ml CH3COOH 0.05 M clear, colorless

Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure. sexual behavior and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.

Function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

Subcellular Location: Secreted protein.

Tissue Specificity: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.

Similarity: Belongs to the NPY family. [1] Coiro,V., Chiodera,P., Melani,A., Manfredi,G., Saccani Jotti,G. and Casti,A.
Different plasma neuropeptide Y concentrations in women athletes with and without menstrual cyclicity
[2] Colton,C.A. and Vitek,M.P., et al.
NPY and chronic neurodegenerative disease
[3] Dutton,M.A., Lee,E.W. and Zukowska,Z., et al.
NPY and extreme stress: lessons learned from posttraumatic stress disorder
[4] Feuerstein,G.Z. and Lee,E.W., et al.
Neuropeptide Y and the heart: implication for myocardial infarction and heart failure
[5] Edvinsson,L., et al.
Neuropeptide Y and the cerebral circulation
[6] Minth C.D., Bloom S.R., Polak J.M., Dixon J.E.
Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine.
[7] Minth C.D., Andrews P.C., Dixon J.E.
Characterization, sequence, and expression of the cloned human neuropeptide Y gene.
[8] Takeuchi T., Gumucio D.L., Yamada T., Meisler M.H., Minth C.D., Dixon J.E., Eddy R.E., Shows T.B.
Genes encoding pancreatic polypeptide and neuropeptide Y are on human chromosomes 17 and 7.
[9] Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., et al.
The DNA sequence of human chromosome 7.
[10] Allen J.M., Polak J.M., Bloom S.R.
Presence of the predicted C-flanking peptide of neuropeptide Y (CPON) in tissue extracts.

Additional Information

Name Neuropeptide Y Human (GWB-282F1B)
Availability In Stock
Related Product Names Neuropeptide Y HumanNPY
Swissprot ID P01303
NCBI Acc Number NP_000896.1
Molecular Weight 10851
Purity > 95%
GI Number 4505449
Stability 6-12 months at -20 degree C.
Reactivity Human
Sequence Length 97
Storage 4 degree C for short term (weeks) and -20 degree C for long term.
Datasheets/Manuals Printable datasheet for GWB-282F1B
Intended Use Research Use Only