PCK1 Antibody (GWB-F9A33D)

GWB-F9A33D

18-003-42292

100 ul
$264.60
Add to Cart

Description

PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.

Additional Information

Name PCK1 Antibody (GWB-F9A33D)
Availability In Stock
Related Product Names PEPCK1; PEPCKC; PEPCK-C
Swissprot ID P35558
Immunogen Synthetic Peptide within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
Immunogen Species Human
NCBI Acc Number NP_002582.2
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 69kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Application WB, IHC
GI Number 32483401
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Human, Mouse, Pig, Rabbit
Sequence Length 622
Datasheets/Manuals Printable datasheet for GWB-F9A33D
Intended Use Research Use Only