PPARGC1B Antibody (GWB-35B4F3)

GWB-35B4F3

18-003-44008

100 ul
$229.00

Description

PPARGC1b is a coactivator of nuclear receptors and other transcription factors that regulates several components of energy metabolism, particularly certain aspects of adaptive thermogenesis in brown fat and skeletal muscle, hepatic gluconeogenesis, and fiber type switching in skeletal muscle.

Additional Information

Name PPARGC1B Antibody (GWB-35B4F3)
Related Product Names Perc; 4631412G21Rik
Immunogen Synthetic Peptide within the following region: KRNEPSFHLSYGGLRHFRWPRYTDYDPTSEESLPSSGKSKYEAMDFDSLL
Swissprot ID Q8VHJ7
Immunogen Species Human
NCBI Acc Number NP_573512.1
Molecular Weight 112kDa
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Application WB
GI Number 18875426
Clonality Polyclonal
Format Lyophilized powder. Add 100 ul of distilled water. Final anti-PPARGC1B antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Reactivity Mouse, Rat
Sequence Length 1014
Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles
Datasheets/Manuals Printable datasheet for GWB-35B4F3
Intended Use Research Use Only