PPARA Antibody (GWB-557F75)

GWB-557F75

18-003-42476

100 ul
$264.60
Add to Cart

Description

Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals which contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor.

Additional Information

Name PPARA Antibody (GWB-557F75)
Related Product Names PPAR; NR1C1; hPPAR; PPARalpha
Immunogen Synthetic Peptide within the following region: IYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLV
Swissprot ID Q07869
Immunogen Species Human
NCBI Acc Number NP_005027.2
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 51kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Application WB
GI Number 7549811
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Dog, Goat, Guinea pig, Horse, Human, Mouse, Pig, Rat
Sequence Length 468
Datasheets/Manuals Printable datasheet for GWB-557F75
Intended Use Research Use Only