PPARD Antibody (GWB-47E292)



100 ul
Add to Cart


PPARD is a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biologic

Additional Information

Name PPARD Antibody (GWB-47E292)
Related Product Names FAAR; NUC1; NUCI; NR1C2; NUCII; PPARB
Immunogen Synthetic Peptide within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
Swissprot ID Q03181
Immunogen Species Human
NCBI Acc Number NP_006229.1
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 49kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Application WB
GI Number 5453940
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rat
Sequence Length 441
Datasheets/Manuals Printable datasheet for GWB-47E292
Intended Use Research Use Only