Description
PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.The protein encoded by this gene is a member of the peroxisome pr
Additional Information
Name | PPARG Antibody (GWB-39A420) |
---|---|
Related Product Names | GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARgamma |
Immunogen | Synthetic Peptide within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL |
Swissprot ID | P37231 |
Immunogen Species | Human |
NCBI Acc Number | NP_056953.2 |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Molecular Weight | 56kDa |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml. |
Purity | Rabbit IgG purified by protein A chromatography. |
Source | Rabbit |
Application | WB |
GI Number | 20336229 |
Clonality | Polyclonal |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Reactivity | Dog, Human, Pig |
Sequence Length | 505 |
Datasheets/Manuals | Printable datasheet for GWB-39A420 |
Intended Use | Research Use Only |