Description
PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.The protein encoded by this gene is a member of the peroxisome pr
Additional Information
| Name | PPARG Antibody (GWB-39A420) |
|---|---|
| Related Product Names | GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARgamma |
| Immunogen | Synthetic Peptide within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL |
| Swissprot ID | P37231 |
| Immunogen Species | Human |
| NCBI Acc Number | NP_056953.2 |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Molecular Weight | 56kDa |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml. |
| Purity | Rabbit IgG purified by protein A chromatography. |
| Source | Rabbit |
| Application | WB |
| GI Number | 20336229 |
| Clonality | Polyclonal |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Reactivity | Dog, Human, Pig |
| Sequence Length | 505 |
| Datasheets/Manuals | Printable datasheet for GWB-39A420 |
| Intended Use | Research Use Only |