PPARG Antibody (GWB-777842)

GWB-777842

18-003-43094

100 ul
$264.60
Add to Cart

Description

PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.

Additional Information

Name PPARG Antibody (GWB-777842)
Availability In Stock
Related Product Names GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARgamma
Immunogen Synthetic Peptide within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI
Swissprot ID P37231
Immunogen Species Human
NCBI Acc Number NP_056953.2
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 56kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Application IHC, WB
GI Number 20336229
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Dog, Goat, Guinea pig, Human, Mouse, Pig, Rabbit, Rat, Sheep
Sequence Length 505
Datasheets/Manuals Printable datasheet for GWB-777842
Intended Use Research Use Only