RXRG Antibody

GWB-A8D256

18-003-44454

100 ul
$264.60
Add to Cart

Description

RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Additional Information

Name RXRG Antibody
Availability In Stock
Related Product Names NR2B3; RXRC
Swissprot ID P48443
Immunogen Synthetic Peptide within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT
Immunogen Species Human
NCBI Acc Number NP_008848.1
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 51kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Application WB
GI Number 5902068
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Dog, Guinea pig, Human, Mouse, Pig, Rat, Zebrafish
Sequence Length 463
Datasheets/Manuals Printable datasheet for GWB-A8D256
Intended Use Research Use Only