In observance of Thanksgiving, Genway Biotech office will be closed on Thursday and Friday, November 22-23, 2018

RXRG Antibody



0.1 mg
Add to Cart


RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Additional Information

Name RXRG Antibody
Related Product Names NR2B3; RXRC
Swissprot ID P48443
Immunogen Synthetic Peptide within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT
Immunogen Species Human
NCBI Acc Number NP_008848.1
Molecular Weight 51kDa
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Applications WB
GI Number 5902068
Clonality Polyclonal
Format Lyophilized powder. Add 100 ul of distilled water. Final anti-RXRG antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Reactivity Bovine, Dog, Guinea pig, Human, Mouse, Pig, Rat, Zebrafish
Sequence Length 463
Storage For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
Datasheets/Manuals Printable datasheet for GWB-A8D256
Intended Use Research Use Only