CDK2 Antibody (GWB-3EA6F0)

GWB-3EA6F0

18-003-42888

100 ul
$299.00
Add to Cart

Description

Cdk2 is probably involved in the control of the cell cycle. It interacts with cyclins A, D, or E. Activity of cdk2 is maximal during S phase and G2.

Additional Information

Name CDK2 Antibody (GWB-3EA6F0)
Related Product Names p33(CDK2)
Swissprot ID P24941
Immunogen Synthetic Peptide within the following region: SKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Immunogen Species Human
NCBI Acc Number NP_001789.2
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 34kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit Ig G is purified by Protein G/A affinity chromatography method.
Source Rabbit
Application WB, IHC
GI Number 16936528
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Sequence Length 298
Datasheets/Manuals Printable datasheet for GWB-3EA6F0
Intended Use Research Use Only