CDK7 Antibody (GWB-5CCA1B)

GWB-5CCA1B

18-003-42889

100 ul
$299.00
Add to Cart

Description

Cdk7 is the catalytic subunit of the CDK-activating kinase (CAK) complex, a serine-threonine kinase. CAK activates the cyclin-associated kinases CDC2/CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcripti

Additional Information

Name CDK7 Antibody (GWB-5CCA1B)
Related Product Names CAK1; CDKN7; MO15; STK1; p39MO15; HCAK
Swissprot ID P50613
Immunogen Synthetic Peptide within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Immunogen Species Human
NCBI Acc Number NP_001790.1
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 39kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit Ig G is purified by Protein G/A affinity chromatography method.
Source Rabbit
Application WB, IHC
GI Number 4502743
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rat
Sequence Length 346
Datasheets/Manuals Printable datasheet for GWB-5CCA1B
Intended Use Research Use Only