TFDP1 Antibody (GWB-843D90)

GWB-843D90

18-003-43022

100 ul
$369.00
Add to Cart

Description

The E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells.

Additional Information

Name TFDP1 Antibody (GWB-843D90)
Related Product Names DP1; Dp-1; DRTF1
Swissprot ID Q14186
Immunogen Synthetic Peptide within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN
Immunogen Species Human
NCBI Acc Number NP_009042.1
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 45kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit Ig G is purified by peptide affinity chromatography method.
Source Rabbit
Application WB, IHC
GI Number 6005900
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Human, Mouse
Sequence Length 410
Datasheets/Manuals Printable datasheet for GWB-843D90
Intended Use Research Use Only