TFDP2 Antibody (GWB-F44294)

GWB-F44294

18-003-42380

100 ul
$299.00
Add to Cart

Description

The TFDP genes encode a family of transcription factors that can form heterodimers with E2F family proteins in vivo. The E2F-TFDP transcription factors are major regulators of genes that are required for the progression of S-phase, such as DHFR and DNA polymerase alpha, and they play a critical role in cell cycle regulation and differentiation.

Additional Information

Name TFDP2 Antibody (GWB-F44294)
Related Product Names DP2
Swissprot ID Q14188-4
Immunogen Synthetic Peptide within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF
Immunogen Species Human
NCBI Acc Number NP_006277.1
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 43kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit IgG purified by protein A chromatography.
Source Rabbit
Application WB, IHC
GI Number 5454112
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Bovine, Dog, Guinea pig, Horse, Human, Mouse, Rabbit, Rat
Sequence Length 386
Datasheets/Manuals Printable datasheet for GWB-F44294
Intended Use Research Use Only