Human IREB1 (Phospho-Ser138) Antibody


Add to Cart


Description: IREB1 (Phospho-Ser138) Antibody detects endogenous levels of IREB1 only when phosphorylated at serine138.

Additional Information

Name Human IREB1 (Phospho-Ser138) Antibody
Related Product Names ACO1, aconitase, Aconitate hydratase, citrate hydro-lyase, Ferritin repressor protein, IRE-BP 1, IRE1, IREBP1, iron regulatory protein 1, iron-responsive element binding protein 1, IRP1
Short Description Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol IREB1
Gene id 48
Alias Symbols ACO1, aconitase, Aconitate hydratase, citrate hydro-lyase, Ferritin repressor protein, IRE-BP 1, IRE1, IREBP1, iron regulatory protein 1, iron-responsive element binding protein 1, IRP1
Swissprot ID P21399
Host Rabbit
Immunogen The antiserum was produced against synthesized peptide derived from human IREB1 around the phosphorylation site of Ser138.
Peptide Sequence Synthetic peptide located within the following region: KLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFE
Molecular Weight 98 kDa
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Specificity IREB1 (Phospho-Ser138) Antibody detects endogenous levels of IREB1 only when phosphorylated at Ser138.
Concentration 1 mg/ml
Applications IHC ELISA
Application Info
IHC: 1:50~1:100
ELISA: 1:1000
GI Number 48
Stability 1 year
Reconstitution and Storage Stable at -20C for at least 1 year.
Reactivity Human
Storage Store at -20C
Datasheets/Manuals Printable datasheet for GWB-ASB506
Intended Use Research Use Only
Additional Information Modification Sites: Human:S138 Mouse:S138 Rat:S138