Human Ku70 (Phospho-Ser5) Antibody


Add to Cart


Description: Ku70 (Phospho-Ser5) Antibody detects endogenous levels of Ku70 only when phosphorylated at serine5.

Additional Information

Name Human Ku70 (Phospho-Ser5) Antibody
Related Product Names X-ray repair cross-complementing protein 6, 5'-deoxyribose-5-phosphate lyase Ku70, 5'-dRP lyase Ku70, X-ray repair complementing defective repair in Chinese hamster cells 6, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70 kDa subu
Gene Symbol XRCC6
Gene id 2547
Alias Symbols X-ray repair cross-complementing protein 6, 5'-deoxyribose-5-phosphate lyase Ku70, 5'-dRP lyase Ku70, X-ray repair complementing defective repair in Chinese hamster cells 6, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70 kDa
Swissprot ID P12956
Host Rabbit
Replacement This antibody may replace item sc-111431 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from human Ku70 around the phosphorylation site of Ser5.
Peptide Sequence Synthetic peptide located within the following region: MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE
Molecular Weight 69 kDa
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Specificity Ku70 (Phospho-Ser5) Antibody detects endogenous levels of Ku70 only when phosphorylated at Ser5.
Concentration 1 mg/ml
Applications WB IHC ELISA
Application Info WB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:1000
GI Number 2547
Stability 1 year
Reconstitution and Storage Stable at -20C for at least 1 year.
Reactivity Human
Storage Store at -20C
Datasheets/Manuals Printable datasheet for GWB-ASB124
Intended Use Research Use Only
Additional Information Modification Sites: Human:S5 Mouse:S6