Human Histone H3.3 (Phospho-Ser31) Antibody (GWB-ASB333)

This exact product is now provided by Aviva Systems Biology.
Please visit OAAF07519 to review further and for ordering information.


GWB-ASB333

100 ug
$329.00
Add to Cart

Description

Description: Histone H3.3 (Phospho-Ser31) Antibody detects endogenous levels of Histone H3.3 only when phosphorylated at serine31.

Additional Information

Name Human Histone H3.3 (Phospho-Ser31) Antibody (GWB-ASB333)
Related Product Names CG5825, H3.3Q, H3.A, H3.B, H33, H3F3A, H3F3B, HIS3.3A, HIS3.3B, ORCG8989, HISH3-3Q, Histone H3.3
Gene Symbol H3F3A
Gene id 3020; 3021
Alias Symbols CG5825, H3.3Q, H3.A, H3.B, H33, H3F3A, H3F3B, HIS3.3A, HIS3.3B, ORCG8989, HISH3-3Q, Histone H3.3
Swissprot ID P84243
Application Info
IF: 1:100~1:500
ELISA: 1:20000
Host Rabbit
Immunogen The antiserum was produced against synthesized peptide derived from human Histone H3.3 around the phosphorylation site of Ser31.
Replacement This antibody may replace item sc-105523 from Santa Cruz Biotechnology.
Peptide Sequence Synthetic peptide located within the following region: APRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK
Molecular Weight 15 kDa
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Specificity Histone H3.3 (Phospho-Ser31) Antibody detects endogenous levels of Histone H3.3 only when phosphorylated at Ser31.
Concentration 1 mg/ml
Application IF ELISA
GI Number 3020
Stability 1 year
Reconstitution and Storage Stable at -20C for at least 1 year.
Reactivity Human
Datasheets/Manuals Printable datasheet for GWB-ASB333
Storage Store at -20C
Species Reactivity Human, Mouse, Rat
Lead Time Domestic: within 1 week delivery  | International: 1 week
Intended Use Research Use Only
Additional Information Modification Sites: Human:S31 Mouse:S31 Rat:S31