Recombinant Mouse APRIL (GWB-0F0231)

GWB-0F0231

Multiple
$0.00

Description

Target APRIL

Protein Sequence AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)

Entrez Gene 69583

Molecular Weight 16.4 kDa

Number of Amino Acids 146

Source Yeast

Bioactivity In testing

Storage -20 C

Shipping Conditions Ambient

Additional Information

Name Recombinant Mouse APRIL (GWB-0F0231)
Related Product Names Tumor necrosis factor ligand superfamily member 13, Tnfsf13, CD256, A proliferation-inducing ligand, April, TNF13
Source Yeast
Format Lyophilized
Reactivity Mouse
Datasheets/Manuals Printable datasheet for GWB-0F0231
Storage Store at -20C
Intended Use Research Use Only