TGFB1I1 Antibody (GWB-8F0CE8) (Aviva Cat. No. ARP33442_P050)

This exact product is available to purchase through Aviva Systems Biology.
Please see item number ARP33442_P050 to view product details and for ordering information.


GWB-8F0CE8

Aviva Cat. No.: ARP33442_P050

18-003-42381

Description

The TGFB1I1 gene encodes a protein that is a key element in the transduction of signals from the cell surface to the nucleus under oxidative stress-review. Higher gene expression may result in unfavorable recurrence-free survival and overall survival in hormone-refractory prostate cancer.

Additional Information

Name TGFB1I1 Antibody (GWB-8F0CE8)
Related Product Names ARA55; HIC-5; HIC5; TSC-5
Swissprot ID B2R8D5
Immunogen Synthetic Peptide within the following region: PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR
Immunogen Species Human
NCBI Acc Number NP_057011.2
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Molecular Weight 48kDa
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Purity Rabbit Ig G is purified by peptide affinity chromatography method.
Source Rabbit
Application IHC, WB
GI Number 21361591
Clonality Polyclonal
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Reactivity Dog, Goat, Guinea pig, Horse, Mouse, Rabbit, Rat
Sequence Length 444
Datasheets/Manuals Printable datasheet for GWB-8F0CE8
Intended Use Research Use Only