Human Tuberin/TSC2 (Phospho-Thr1462) Antibody (GWB-ASB238)

This exact product is now provided by Aviva Systems Biology.
Please visit OAAF07450 to review further and for ordering information.


Add to Cart


Description: Tuberin/TSC2 (Phospho-Thr1462) Antibody detects endogenous levels of Tuberin/TSC2 only when phosphorylated at threonine1462.

Additional Information

Name Human Tuberin/TSC2 (Phospho-Thr1462) Antibody (GWB-ASB238)
Related Product Names TSC2, tuberous sclerosis 2 gene, Tuberous sclerosis 2 homolog protein, Tuberous sclerosis 2 protein
Short Description Click here to learn more about Aviva's By-Request Conjugation Service.
Immunogen The antiserum was produced against synthesized peptide derived from human Tuberin/TSC2 around the phosphorylation site of Thr1462.
Gene Symbol TSC2
Gene id 7249
Alias Symbols TSC2, tuberous sclerosis 2 gene, Tuberous sclerosis 2 homolog protein, Tuberous sclerosis 2 protein
Swissprot ID P49815
Host Rabbit
Peptide Sequence Synthetic peptide located within the following region: AAWSASGEDSRGQPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVER
Molecular Weight 200 kDa
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Specificity Tuberin/TSC2 (Phospho-Thr1462) Antibody detects endogenous levels of Tuberin/TSC2 only when phosphorylated at Thr1462.
Concentration 1 mg/ml
Application IHC ELISA
GI Number 7249
Stability 1 year
Reconstitution and Storage Stable at -20C for at least 1 year.
Reactivity Human
Application Info
IHC: 1:50~1:100
ELISA: 1:1000
Storage Store at -20C
Datasheets/Manuals Printable datasheet for GWB-ASB238
Conjugation Option

GWB-ASB238-FITC Conjugated

GWB-ASB238-HRP Conjugated

GWB-ASB238-Biotin Conjugated

Species Reactivity Human, Mouse, Rat
Intended Use Research Use Only
Additional Information Modification Sites: Human:T1462 Mouse:T1465 Rat:T1466