MECP2 Human Protein (GWB-BSP531)

GWB-BSP531

$0.00
Add to Cart

Description

MECP2 Human Recombinant is expressed in 293 cells. The protein containing 486 amino acids (1-486a.a.) fused to a N-terminal Flag tag, having a Mw of 53.56kDa.

Additional Information

Name MECP2 Human Protein (GWB-BSP531)
Related Product Names Methyl CpG binding protein 2 (Rett syndrome), MeCp-2 protein, AUTSX3, MRX16, MRX79, MRXS13, MRXSL, PPMX, RTT, Mental retardation, X-linked 16, DKFZp686A24160.
Peptide Sequence MDYKDDDDKMVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSA EPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAG KYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGT GRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMV IKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIE VKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVP LLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAA EKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS.
Product Format Sterile Filtered colorless solution. The MECP2 solution contains 50mM Tris, 135mM NaCl, 20% Glycerol, pH 7.5 and 200 ug/ml FLAG peptide.
Purity Greater than 80% as determined by SDS-PAGE.
Source Mammalian system, 293 cells.
Reconstitution and Storage MECP2 although stable 4°C for 4 weeks, should be stoed below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid mulitple freeze-thaw cycles.
Reactivity Human
Datasheets/Manuals Printable datasheet for GWB-BSP531
Intended Use Research Use Only