MET Human Protein (GWB-BSP533)

GWB-BSP533

$0.00
Add to Cart

Additional Information

Name MET Human Protein (GWB-BSP533)
Alias Symbols Hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, Proto-oncogene c-Met, Scatter factor receptor, SF receptor, Tyrosine-protein kinase Met, MET,HGFR, AUTS9, RCCP2.
Description of Target Mesenchymal epithelial transition factor (c-MET) is a proto-oncogenic receptor tyrosine kinase. The endogenous ligand for c-MET is HGF (hepatocyte growth factor), which is a disulfide-linked heterodimeric molecule produced predominantly by mesenchymal cells. In the adult, c-MET protein expression is limited to stem and progenitor cells and is required for wound healing and hepatocyte regeneration. In the embryo, c-MET receptors are expressed on cells of epithelial origin, which are vital for invasive growth and mediate epithelial-mesenchymal transition (EMT). Abnormal activation of the HGF/MET pathway leads to a variety of cancers. c-MET mutation is linked with a poor prognosis since it can trigger tumor growth, angiogenesis and metastasis.
Immunogen Met Proto-Oncogene Human Recombinant produced in Insect cells amino acids 1039-1345
Product Format Liquid. 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5
Molecular Weight 35 kDa
Purification MET is purified by proprietary chromatographic techniques
Concentration 1 mg/ml
Purity Greater than 90.0% as determined by SDS-PAGE
Source Insect cells
Protein Sequence DSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTL LDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVL PYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDE KFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFG VLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEM RPSFSELVSRISAIFSTFI
Reconstitution and Storage Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time.
Please avoid freeze thaw cycles.
Reactivity Human
Datasheets/Manuals Printable datasheet for GWB-BSP533
Intended Use Research Use Only