In observance of Thanksgiving, Genway Biotech office will be closed on Thursday and Friday, November 22-23, 2018

Human XPF Antibody

GWB-ASD256

$0.00
Add to Cart

Description

Description: XPF Antibody detects endogenous levels of total XPF protein.

Additional Information

Name Human XPF Antibody
Related Product Names DNA excision repair protein ERCC-4, DNA repair endonuclease XPF, excision repair cross-complementing rodent repair deficiency, complementation group 4
Gene Symbol ERCC4
Gene id 2072
Alias Symbols DNA excision repair protein ERCC-4, DNA repair endonuclease XPF, excision repair cross-complementing rodent repair deficiency, complementation group 4
Swissprot ID Q92889
Host Rabbit
Replacement This antibody may replace item sc-10159 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from human XPF.
Peptide Sequence Synthetic peptide located within the following region: LWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPESEKYNPGPQD
Molecular Weight 103 kDa
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Specificity XPF Antibody detects endogenous levels of total XPF protein.
Concentration 1 mg/ml
Applications WB ELISA
Application Info WB: 1:500~1:1000
ELISA: 1:10000
GI Number 2072
Stability 1 year
Reconstitution and Storage Stable at -20C for at least 1 year.
Reactivity Human
Storage Store at -20C
Datasheets/Manuals Printable datasheet for GWB-ASD256
Intended Use Research Use Only