Web Analytics

In observance of Memorial Day, Genway Biotech office will be closed on Monday, May 28th, 2018

Human XPF Antibody


Add to Cart


Description: XPF Antibody detects endogenous levels of total XPF protein.

Additional Information

Name Human XPF Antibody
Related Product Names DNA excision repair protein ERCC-4, DNA repair endonuclease XPF, excision repair cross-complementing rodent repair deficiency, complementation group 4
Drywet Surcharge 0
Gene Symbol ERCC4
Gene id 2072
Alias Symbols DNA excision repair protein ERCC-4, DNA repair endonuclease XPF, excision repair cross-complementing rodent repair deficiency, complementation group 4
Swissprot ID Q92889
Species Reactivity Human, Mouse
Host Rabbit
Replacement This antibody may replace item sc-10159 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from human XPF.
Peptide Sequence Synthetic peptide located within the following region: LWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPESEKYNPGPQD
Molecular Weight 103 kDa
Datasheets / Downloads GWB-ASD256 Datasheet
Swiss Prot Number Q92889
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Specificity XPF Antibody detects endogenous levels of total XPF protein.
Concentration 1 mg/ml
Applications WB ELISA
Application Info WB: 1:500~1:1000
ELISA: 1:10000
GI Number 2072
Stability 1 year
Reconstitution and Storage Stable at -20C for at least 1 year.
Reactivity Human
Storage Store at -20C
Intended Use Research Use Only