Human YB1 (Phospho-Ser102) Antibody


Add to Cart


Description: YB1 (Phospho-Ser102) Antibody detects endogenous levels of YB1 only when phosphorylated at serine102.

Additional Information

Name Human YB1 (Phospho-Ser102) Antibody
Related Product Names CBF-A, CCAAT-binding transcription factor I subunit A, DBPB, DNA-binding protein B, EFI-A, Enhancer factor I subunit A, MSY-1, NSEP1, Nuclease sensitive element binding protein 1, Y box binding protein-1, Y-box transcription factor, YB1, YBOX1, YBX1
Gene Symbol YBX1
Gene id 4904
Alias Symbols CBF-A, CCAAT-binding transcription factor I subunit A, DBPB, DNA-binding protein B, EFI-A, Enhancer factor I subunit A, MSY-1, NSEP1, Nuclease sensitive element binding protein 1, Y box binding protein-1, Y-box transcription factor, YB1, YBOX1
Swissprot ID P67809
Host Rabbit
Replacement This antibody may replace item sc-101198 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from human YB1 around the phosphorylation site of Ser102.
Peptide Sequence Synthetic peptide located within the following region: VRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGE
Molecular Weight 35 kDa
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Specificity YB1 (Phospho-Ser102) Antibody detects endogenous levels of YB1 only when phosphorylated at Ser102.
Concentration 1 mg/ml
Applications WB ELISA
Application Info WB: 1:500~1:1000
ELISA: 1:40000
GI Number 4904
Stability 1 year
Reconstitution and Storage Stable at -20C for at least 1 year.
Reactivity Human
Storage Store at -20C
Datasheets/Manuals Printable datasheet for GWB-ASC029
Intended Use Research Use Only
Additional Information Modification Sites: Human:S102 Mouse:S100 Rat:S100