YBX2 Antibody

GWB-F7DC7A
18-003-42530
0.1 mg
$268
Add to Cart

* Required Fields

Description

YBX2 is a member of the Y box multigene family of proteins; it contains the cold shock domain that is highly conserved among all Y box proteins and four basic/aromatic islands. By Northern blotting and immunoblotting, MSY2 appears to be a germ cell-specific protein in the testis. In the ovary, MSY2 is present exclusively in diplotene-stage and mature oocytes. MSY2 is maternally inherited in the one-cell-stage embryo but is not detected in the late two-cell-stage embryo. This loss of MSY2 is coincident with the bulk degradation of maternal mRNAs in the two-cell embryo.

Additional Information

Name YBX2 Antibody
Related Product Names DBPC; MSY2; CSDA3; CONTRIN
Immunogen Synthetic Peptide within the following region: RKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPP
Immunogen Species Human
Intended Use Research Use Only
NCBI Acc Number NP_057066.2
GI Number 156415990
Purity Rabbit IgG purified by protein A chromatography.
Format Lyophilized powder. Add 100 ul of distilled water. Final anti-YBX2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Clonality Polyclonal
Storage For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
Molecular Weight 39kDa
Sequence Length 364
Swiss Prot Number Q9Y2T7
Applications WB, IHC